PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G1543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 274aa    MW: 30532 Da    PI: 8.6355
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G1543genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-072974346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT +E +++ +a +++      +W  +a++++ g+t  +++  ++ 
      Gh_D09G1543 29 KWTHQENKRFENALALYDQQtpdRWFNVAAMIP-GKTVADVIKQYRE 74
                     7*****************99*************.*******999986 PP

2Myb_DNA-binding41.14.2e-13128172347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ + +++G+g+W++I+r + ++ t+ q+ s+ qky
      Gh_D09G1543 128 PWTEDEHRQFLMGLRKYGKGDWRSISRNFVTTTTPTQVASHAQKY 172
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.2482580IPR017884SANT domain
SMARTSM007171.1E-62678IPR001005SANT/Myb domain
CDDcd001679.19E-72975No hitNo description
PfamPF002495.6E-62974IPR001005SANT/Myb domain
SuperFamilySSF466893.29E-102982IPR009057Homeodomain-like
PROSITE profilePS5129416.247120177IPR017930Myb domain
SuperFamilySSF466898.97E-16123176IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-17124176IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.5E-10125172IPR009057Homeodomain-like
SMARTSM007171.5E-10125175IPR001005SANT/Myb domain
CDDcd001676.59E-9128173No hitNo description
PfamPF002491.0E-10128172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MMNRGFEILS PPSYSHASNW LFQESKDIKW THQENKRFEN ALALYDQQTP DRWFNVAAMI  60
PGKTVADVIK QYRELEEDVS DIEAGWLIPI PGYLTDSFTF NWVNNHTPGG KTGTGTPPCD  120
QERNKGVPWT EDEHRQFLMG LRKYGKGDWR SISRNFVTTT TPTQVASHAQ KYFIRQLTGG  180
KDKRRSSIHD VTTLNIANTP SSSPDHGKPS SPKNASAVSG VTNEGAAIVF DQRSSGNALL  240
SPFCKVPSYG PKLDEQNLAS GTLPTSQFGS YRGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1530951175RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486204.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-87DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2NUG80.0A0A0D2NUG8_G
STRINGPOPTR_0016s11980.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-104MYB family protein